| Title | NMR Solution Structure of the Partially Disordered Protein At2g23090 from Arabidopsis thaliana. To be Published | | Site | CESG | | PDB Id | | Target Id | GO.7474 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS29828,6432 | Molecular Weight | 8375.44 Da. | | Residues | 78 | Isoelectric Point | 9.64 | | Sequence | mgggnaqksamaraknlekakaagkgsqleankkamsiqckvcmqtficttsevkcrehaeakhpkadv vacfphlkk | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
