| Title | Structure of T4moC, the Rieske-type ferredoxin component of toluene 4-monooxygenase. Acta Crystallogr.,Sect.D 62 476-482 2006 | | Site | CESG | | PDB Id | | Target Id | GO.34660 | | Molecular Characteristics | | Source | Pseudomonas mendocina kr1 | | Alias Ids | TPS30171, | Molecular Weight | 12260.97 Da. | | Residues | 112 | Isoelectric Point | 4.38 | | Sequence | msfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggvitcrahlw tfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.48 | Rfree | 0.1759 | | Matthews' coefficent | 2.01 | Rfactor | 0.1548 | | Waters | 133 | Solvent Content | 38.67 |
| Ligand Information | | Ligands | FES (FE2/S2) x 1;EDO (1,2-ETHANEDIOL) x 3 | | Metals | MG (MAGNESIUM) x 2 | | |
