| Title | Structure at 1.6 A resolution of the protein from gene locus At3g22680 from Arabidopsis thaliana. Acta Crystallogr.,Sect.F 61 647-650 2005 | | Site | CESG | | PDB Id | | Target Id | GO.13974 | | Related PDB Ids 3gan | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS29830, | Molecular Weight | 18025.33 Da. | | Residues | 157 | Isoelectric Point | 5.11 | | Sequence | melrpsgdsgssdvdaeisdgfspldtshrdvadegsllrraemyqdymkqvpiptnrgslipftswvg lsismkqlygqplhyltnvllqrwdqsrfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmal lwrsdpmyhsfidpifpek | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.60 | Rfree | 0.1835 | | Matthews' coefficent | 3.38 | Rfactor | 0.1599 | | Waters | 172 | Solvent Content | 63.63 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 3;CPS (3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-) x 1;EDO (1,2-ETHANEDIOL) x 4 | | Metals | | | |
