| Title | 1H, 15N and 13C resonance assignments of the putative Bet v 1 family protein At1g24000.1 from Arabidopsis thaliana. J.Biomol.Nmr 32 335-335 2005 | | Site | CESG | | PDB Id | | Target Id | GO.5358 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30336, | Molecular Weight | 13801.20 Da. | | Residues | 122 | Isoelectric Point | 6.42 | | Sequence | mtlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiqkyfktlkgs iavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnfke | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.10 | Rfree | 0.2392 | | Matthews' coefficent | 2.22 | Rfactor | 0.1857 | | Waters | 106 | Solvent Content | 44.49 |
| Ligand Information | | Ligands | | | Metals | | | |
