| Title | Letter to the Editor: Solution structure of a calmodulin-like calcium-binding domain from Arabidopsis thaliana. J.Biomol.NMR 30 451-456 2004 | | Site | CESG | | PDB Id | | Target Id | GO.33909 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30338,6209 | Molecular Weight | 7776.33 Da. | | Residues | 67 | Isoelectric Point | 4.40 | | Sequence | msakrvfekfdknkdgklsldefrevalafspyftqedivkffeeidvdgngelnadeftsciekml | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
