| Title | Crystal structure of the protein from gene At3g17210 of Arabidopsis thaliana. Proteins 57 218-220 2004 | | Site | CESG | | PDB Id | | Target Id | GO.13081 | | Related PDB Ids 1q53 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30302,5843 | Molecular Weight | 12183.36 Da. | | Residues | 109 | Isoelectric Point | 5.42 | | Sequence | meeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgythifestfe skeavaeyiahpahvefatiflgsldkvlvidykptsvsl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.90 | Rfree | 0.2323 | | Matthews' coefficent | 1.95 | Rfactor | 0.18217 | | Waters | 109 | Solvent Content | 36.50 |
| Ligand Information | | Ligands | | | Metals | MG (MAGNESIUM) x 1 | | |
