| Title | Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics. Chem.Biol. 16 401-410 2009 | | Site | BSGI | | PDB Id | | Target Id | MTFA_AMYOR | | Molecular Characteristics | | Source | Amycolatopsis orientalis | | Alias Ids | TPS26956, | Molecular Weight | 30484.71 Da. | | Residues | 280 | Isoelectric Point | 5.05 | | Sequence | msnqlergpvrtphadvllasvgergvlcdfydegaadtyrdliqdadgtsearefatrtgpvsgpvle laagmgrltfpfldlgwevtalelstsvlaafrkrlaeapadvrdrctlvqgdmsafaldkrfgtvvis sgsineldeadrrglyasvrehlepggkfllslamseaaeseplerkqelpgrsgrryvlhvrhlpaee iqeitihpadettdpfvvcthrrrllapdqvvrelvrsgfdviaqtpfasggagrkdmvlveavmpgat adar | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.18 | Rfree | 0.253 | | Matthews' coefficent | 2.55 | Rfactor | 0.226 | | Waters | 124 | Solvent Content | 51.77 |
| Ligand Information | | Ligands | SFG (ADENOSYL-ORNITHINE) x 2 | | Metals | | | |
