| Title | Structure of L-xylulose-5-phosphate 3-epimerase UlaE from the Anaerobic L-ascorbate Utilization Pathway of Escherichia coli. Binding Motif within a TIM Barrel Fold. J.Bacteriol. 2008 | | Site | BSGI | | PDB Id | | Target Id | ULAE_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11996, | Molecular Weight | 32046.99 Da. | | Residues | 284 | Isoelectric Point | 5.13 | | Sequence | mlskqiplgiyekalpagecwlerlqlaktlgfdfvemsvdetderlsrldwsreqrlalvnaivetgv rvpsmclsahrrfplgseddavraqgleimrkaiqfaqdvgirviqlagydvyyqeannetrrrfrdgl kesvemasraqvtlameimdyplmnsiskalgyahylnnpwfqlypdignlsawdndvqmelqagighi vavhvkdtkpgvfknvpfgegvvdfercfetlkqsgycgpyliemwsetaedpaaevakardwvkarma kagmveaa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.04 | Rfree | 0.213 | | Matthews' coefficent | 2.20 | Rfactor | 0.183 | | Waters | 193 | Solvent Content | 44.13 |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 4 | | |
