.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b8p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Nat.Struct.Mol.Biol. 15 130-138 2008
    Site BSGI
    PDB Id 3b8p Target Id WZZB_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11928, Molecular Weight 36289.62 Da.
    Residues 325 Isoelectric Point 5.30
    Sequence mrvennnvsgqnhdpeqidlidllvqlwrgkmtiiisvivaialaigylavakekwtstaiitqpdvgq iagynnamnviygqaapkvsdlqetligrfssafsalaetldnqeepekltiepsvknqqlpltvsyvg qtaegaqmklaqyiqqvddkvnqelekdlkdnialgrknlqdslrtqevvaqeqkelrirqiqealqya nqaqvakpqvqqtedvtqdtlfllgsealesmikheatrplvfspnyyqtrqnlldienlkvddldiha yryvmkptlpirrdspkkaitlilavllggmvgagivlgrnalrnynak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 3.10 Rfree 0.30149
    Matthews' coefficent 3.06 Rfactor 0.25462
    Waters Solvent Content 59.80

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch