| Title | Structure and heme binding properties of Escherichia coli O157:H7 ChuX. Protein Sci. 18 825-838 2009 | | Site | BSGI | | PDB Id | | Target Id | CHUX_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11994, | Molecular Weight | 18327.89 Da. | | Residues | 164 | Isoelectric Point | 5.75 | | Sequence | mshvslqeflktepdgtlevvaeqynttllevvrnlpsstvvpgdkfdtvwdtvcewgnvttlvhtadv ilefsgelpsgfhrhgyfnlrgkhgmsghikaencthialierkfmgmdtasilffnkegsamlkiflg rddhrqllseqvsafhtlaaslkeha | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.05 | Rfree | 0.25 | | Matthews' coefficent | 2.81 | Rfactor | 0.213 | | Waters | 360 | Solvent Content | 56.25 |
| Ligand Information | | Ligands | | | Metals | | | |
