| Title | Structure of [NiFe] hydrogenase maturation protein HypE from Escherichia coli and its interaction with HypF. J.Bacteriol. 190 1447-1458 2008 | | Site | BSGI | | PDB Id | | Target Id | HYPE_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11989, | Molecular Weight | 33735.96 Da. | | Residues | 322 | Isoelectric Point | 4.97 | | Sequence | mqqlinslfmeafanpwlaeqedqarldlaqlvaegdrlafstdsyvidplffpggnigklaicgtand vavsgaiprylscgfileeglpmetlkavvtsmaetartagiaivtgdtkvvqrgaadklfintagmga iptnihwgaqtltagdillvsgtlgdhgatilnlreqlgldgelvsdcavltpliqtlrdipgvkalrd atrggvnavvhexaaacgcgieisesalpvkpavrgvcellgldalnfanegklviavernaaeqvlaa lhshplgkdaaligevverkgvrlaglygvkrtldlphaeplpric | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.51 | Rfree | 0.24 | | Matthews' coefficent | 3.33 | Rfactor | 0.193 | | Waters | 397 | Solvent Content | 63.03 |
| Ligand Information | | Ligands | | | Metals | | | |
