| Title | NMR structure of YcgL, a conserved protein from Escherichia coli representing the DUF709 family, with a novel alpha/beta/alpha sandwich fold. Proteins 66 1004-1007 2007 | | Site | BSGI | | PDB Id | | Target Id | YCGL_ECOL6 | | Molecular Characteristics | | Source | Escherichia coli cft073 | | Alias Ids | TPS11932, | Molecular Weight | 12413.89 Da. | | Residues | 108 | Isoelectric Point | 9.16 | | Sequence | mpkpgilksksmfcviyrsskrdqtylyvekkddfsrvpeelmkgfgqpqlamilpldgrkklvnadie kvkqalteqgyylqlppppedllkqhlsvmgqktddtnk | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
