| Title | Crystal structure of PhnH: an essential component of carbon-phosphorus lyase in Escherichia coli. J.Bacteriol. 190 1072-1083 2008 | | Site | BSGI | | PDB Id | | Target Id | PHNH_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11961, | Molecular Weight | 21026.09 Da. | | Residues | 194 | Isoelectric Point | 5.28 | | Sequence | mtletafmlpvqdaqhsfrrllkamsepgvivalhqlkrgwqplniattsvlltladndtpvwlstpln ndivnqslrfhtnaplvsqpeqatfavtdeaisseqlnalstgtavapeagatlilqvaslsggrmlrl tgagiaeermiapqlpecilhelterphpfplgidliltcgerllaiprtthvevc | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.70 | Rfree | 0.24842 | | Matthews' coefficent | 1.93 | Rfactor | 0.18789 | | Waters | 184 | Solvent Content | 36.22 |
| Ligand Information | | Ligands | ACT (ACETATE) x 1 | | Metals | NA (SODIUM) x 4 | | |
