.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fpu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structural snapshots of Escherichia coli histidinol phosphate phosphatase along the reaction pathway. J.Biol.Chem. 281 37930-37941 2006
    Site BSGI
    PDB Id 2fpu Target Id HIS7_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11983, Molecular Weight 40419.10 Da.
    Residues 356 Isoelectric Point 5.86
    Sequence mmsqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtqsfpqad fdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdransyvigdratdiql aenmginglrydretlnwpmigeqltrrdryahvvrntketqidvqvwldreggskintgvgffdhmld qiathggfrmeinvkgdlyiddhhtvedtglalgealkialgdkrgicrfgfvlpmdeclarcaldisg rphleykaeftyqrvgdlstemiehffrslsytmgvtlhlktkgkndhhrveslfkafgrtlrqairve gdtlpsskgvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.22296
    Matthews' coefficent 2.52 Rfactor 0.18349
    Waters 481 Solvent Content 51.24

    Ligand Information
    Ligands HSO (HISTIDINOL) x 1
    Metals CL (CHLORIDE) x 4;ZN (ZINC) x 2;MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch