| Title | Structural snapshots of Escherichia coli histidinol phosphate phosphatase along the reaction pathway. J.Biol.Chem. 281 37930-37941 2006 | | Site | BSGI | | PDB Id | | Target Id | HIS7_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11983, | Molecular Weight | 40419.10 Da. | | Residues | 356 | Isoelectric Point | 5.86 | | Sequence | mmsqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtqsfpqad fdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdransyvigdratdiql aenmginglrydretlnwpmigeqltrrdryahvvrntketqidvqvwldreggskintgvgffdhmld qiathggfrmeinvkgdlyiddhhtvedtglalgealkialgdkrgicrfgfvlpmdeclarcaldisg rphleykaeftyqrvgdlstemiehffrslsytmgvtlhlktkgkndhhrveslfkafgrtlrqairve gdtlpsskgvl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.80 | Rfree | 0.22296 | | Matthews' coefficent | 2.52 | Rfactor | 0.18349 | | Waters | 481 | Solvent Content | 51.24 |
| Ligand Information | | Ligands | HSO (HISTIDINOL) x 1 | | Metals | CL (CHLORIDE) x 4;ZN (ZINC) x 2;MG (MAGNESIUM) x 2 | | |
