| Title | Modulator of drug activity B from Escherichia coli: crystal structure of a prokaryotic homologue of DT-diaphorase. J.Mol.Biol. 359 455-465 2006 | | Site | BSGI | | PDB Id | | Target Id | MDAB_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11991, | Molecular Weight | 21889.85 Da. | | Residues | 193 | Isoelectric Point | 5.85 | | Sequence | msniliingakkfahsngqlndtltevadgtlrdlghdvrivradsdydvkaevqnflwadvviwqmpg wwmgapwtvkkyiddvfteghgtlyasdgrtrkdpskkygsgglvqgkkymlsltwnapmeaftekdqf fhgvgvdgvylpfhkanqflgmeplptfiandvikmpdvpryteeyrkhlveifg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.80 | Rfree | 0.263 | | Matthews' coefficent | 2.20 | Rfactor | 0.233 | | Waters | 586 | Solvent Content | 42.00 |
| Ligand Information | | Ligands | | | Metals | | | |
