| Title | Crystal structure of a novel prokaryotic Ser/Thr kinase and its implication in the Cpx stress response pathway. Mol.Microbiol. 63 1360-1371 2007 | | Site | BSGI | | PDB Id | | Target Id | RDOA_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11975, | Molecular Weight | 38118.37 Da. | | Residues | 328 | Isoelectric Point | 4.99 | | Sequence | mnnsaftfqtlhpdtimdalfehgirvdsgltplnsyenrvyqfqdedrrrfvvkfyrperwtadqile ehqfalqlvndevpvaapvafngqtllnhqgfyfavfpsvggrqfeadnidqmeavgrylgrmhqtgrk qlfihrptiglneylieprklfedatlipsglkaaflkatdeliaavtahwredftvlrlhgdchagni lwrdgpmfvdlddarngpavqdlwmllngdkaeqrmqletiieayeefsefdtaeiglieplramrlvy ylawlmrrwadpafpknfpwltgedywlrqtatfieqakvlqepplqltpmy | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.80 | Rfree | 0.279 | | Matthews' coefficent | 2.90 | Rfactor | 0.215 | | Waters | | Solvent Content | 56.60 |
| Ligand Information | | Ligands | | | Metals | | | |
