| Title | Solution structure of the carbon storage regulator protein CsrA from Escherichia coli. J.Bacteriol. 187 3496-3501 2005 | | Site | BSGI | | PDB Id | | Target Id | CSRA_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11936, | Molecular Weight | 6855.58 Da. | | Residues | 61 | Isoelectric Point | 8.16 | | Sequence | mliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqqssy | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 2 |
| Ligand Information | | Ligands | | | Metals | | | |