.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u9t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Identification of an Escherichia coli O157:H7 heme oxygenase with tandem functional repeats. Proc.Natl.Acad.Sci.Usa 102 16955-16960 2005
    Site BSGI
    PDB Id 1u9t Target Id CHUS_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11993, Molecular Weight 38698.82 Da.
    Residues 342 Isoelectric Point 5.48
    Sequence mnhytrwlelkeqnpgkyardiaglmnireaelafarvthdawrmhgdireilaalesvgetkcicrne yavheqvgtftnqhlnghaglilnpraldlrlflnqwasvfhikentargerqsiqffdhqgdallkvy atdntdmaawsellarfitdentplelkavdapvvqtradatvveqewramtdvhqfftllkrhnltrq qafnlvaddlackvsnsalaqilesaqqdgneimvfvgnrgcvqiftgvvekvvpmkgwlnifnptftl hlleesiaeawvtrkptsdgyvtslelfahdgtqiaqlygqrtegeqeqaqwrkqiaslipegvaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.16 Rfree 0.283
    Matthews' coefficent 1.79 Rfactor 0.207
    Waters 336 Solvent Content 30.62

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch