| Title | Identification of an Escherichia coli O157:H7 heme oxygenase with tandem functional repeats. Proc.Natl.Acad.Sci.Usa 102 16955-16960 2005 | | Site | BSGI | | PDB Id | | Target Id | CHUS_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11993, | Molecular Weight | 38698.82 Da. | | Residues | 342 | Isoelectric Point | 5.48 | | Sequence | mnhytrwlelkeqnpgkyardiaglmnireaelafarvthdawrmhgdireilaalesvgetkcicrne yavheqvgtftnqhlnghaglilnpraldlrlflnqwasvfhikentargerqsiqffdhqgdallkvy atdntdmaawsellarfitdentplelkavdapvvqtradatvveqewramtdvhqfftllkrhnltrq qafnlvaddlackvsnsalaqilesaqqdgneimvfvgnrgcvqiftgvvekvvpmkgwlnifnptftl hlleesiaeawvtrkptsdgyvtslelfahdgtqiaqlygqrtegeqeqaqwrkqiaslipegvaa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.16 | Rfree | 0.283 | | Matthews' coefficent | 1.79 | Rfactor | 0.207 | | Waters | 336 | Solvent Content | 30.62 |
| Ligand Information | | Ligands | | | Metals | | | |
