| Title | Identification of an ITPase/XTPase in Escherichia coli by Structural and Biochemical Analysis. Structure 13 1511-1520 2005 | | Site | BSGI | | PDB Id | | Target Id | YJJX_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11977, | Molecular Weight | 18211.65 Da. | | Residues | 170 | Isoelectric Point | 5.73 | | Sequence | mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrvanarrllpea dfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregealgpvmsrytgideigrkeg aigvftagkltrasvyhqavilalspfhnavy | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 7 | | Resolution (Å) | 2.30 | Rfree | 0.255 | | Matthews' coefficent | 2.40 | Rfactor | 0.2 | | Waters | 682 | Solvent Content | 49.40 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 15 | | Metals | | | |
