| Title | NMR structure of the enzyme GatB of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system and its interaction with GatA. Protein Sci. 15 2435-2441 2006 | | Site | BSGI | | PDB Id | | Target Id | PTKB_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11984, | Molecular Weight | 10194.43 Da. | | Residues | 94 | Isoelectric Point | 5.84 | | Sequence | mkrkiivacggavatstmaaeeikelcqshnipveliqcrvneietymdgvhlicttarvdrsfgdipl vhgmpfvsgvgiealqnkiltilqg | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
