.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tq5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structural and biochemical analysis reveal pirins to possess quercetinase activity. J.Biol.Chem. 280 28675-28682 2005
    Site BSGI
    PDB Id 1tq5 Target Id YHHW_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11974, Molecular Weight 26278.09 Da.
    Residues 231 Isoelectric Point 5.21
    Sequence miylrkanerghanhgwldswhtfsfanyydpnfmgfsalrvinddvieagqgfgthphkdmeiltyvl egtvehqdsmgnkeqvpagefqimsagtgirhseynpssterlhlyqiwimpeengitpryeqrrfdav qgkqlvlspdardgslkvhqdmelyrwallkdeqsvhqiaaerrvwiqvvkgnvtingvkastsdglai wdeqaisihadsdsevllfdlppv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.2503
    Matthews' coefficent 2.00 Rfactor 0.1972
    Waters 142 Solvent Content 37.00

    Ligand Information
    Ligands
    Metals CD (CADMIUM) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch