| Title | Structural and biochemical analysis reveal pirins to possess quercetinase activity. J.Biol.Chem. 280 28675-28682 2005 | | Site | BSGI | | PDB Id | | Target Id | YHHW_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11974, | Molecular Weight | 26278.09 Da. | | Residues | 231 | Isoelectric Point | 5.21 | | Sequence | miylrkanerghanhgwldswhtfsfanyydpnfmgfsalrvinddvieagqgfgthphkdmeiltyvl egtvehqdsmgnkeqvpagefqimsagtgirhseynpssterlhlyqiwimpeengitpryeqrrfdav qgkqlvlspdardgslkvhqdmelyrwallkdeqsvhqiaaerrvwiqvvkgnvtingvkastsdglai wdeqaisihadsdsevllfdlppv | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.76 | Rfree | 0.2503 | | Matthews' coefficent | 2.00 | Rfactor | 0.1972 | | Waters | 142 | Solvent Content | 37.00 |
| Ligand Information | | Ligands | | | Metals | CD (CADMIUM) x 6 | | |
