| Title | The solution structure of ChaB, a putative membrane ion antiporter regulator from Escherichia coli. BMC STRUCT.BIOL. 4 9 2004 | | Site | BSGI | | PDB Id | | Target Id | CHAB_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11981, | Molecular Weight | 8944.39 Da. | | Residues | 76 | Isoelectric Point | 6.50 | | Sequence | mpyktksdlpesvkhvlpshaqdiykeafnsawdqykdkedrrddasreetahkvawaavkheyakgdd dkwhkks | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
