| Title | Solution Structure of YaeO, a Rho-specific Inhibitor of Transcription Termination. J.Biol.Chem. 282 23348-23353 2007 | | Site | BSGI | | PDB Id | | Target Id | ROF_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11963, | Molecular Weight | 9479.14 Da. | | Residues | 84 | Isoelectric Point | 4.63 | | Sequence | mndtyqpincddydnlelacqhhlmltlelkdgeklqakasdlvsrknveylvveaagetrelrldkit sfshpeigtvvvses | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
