| Title | Structural and biochemical evidence for an enzymatic quinone redox cycle in Escherichia coli: identification of a novel quinol monooxygenase. J.Biol.Chem. 280 8358-8363 2005 | | Site | BSGI | | PDB Id | | Target Id | YGIN_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11972, | Molecular Weight | 11531.81 Da. | | Residues | 104 | Isoelectric Point | 5.79 | | Sequence | mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsivmieqwesi ahleahlqtphmkayseavkgdvlemnirilqpgi | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.20 | Rfree | 0.24948 | | Matthews' coefficent | 3.43 | Rfactor | 0.20842 | | Waters | 185 | Solvent Content | 64.16 |
| Ligand Information | | Ligands | | | Metals | | | |
