| Title | Crystal structures of Escherichia coli ATP-dependent glucokinase and its complex with glucose. J.Bacteriol. 186 6915-6927 2004 | | Site | BSGI | | PDB Id | | Target Id | GLK_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11986, | Molecular Weight | 34721.16 Da. | | Residues | 321 | Isoelectric Point | 6.06 | | Sequence | mtkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgciaiacpitg dwvamtnhtwafsiaemkknlgfshleiindftavsmaipmlkkehliqfggaepvegkpiavygagtg lgvahlvhvdkrwvslpgegghvdfapnseeeaiileilraeighvsaervlsgpglvnlyraivkadn rlpenlkpkditeraladsctdcrralslfcvimgrfggnlalnlgtfggvfiaggivprfleffkasg fraafedkgrfkeyvhdipvylivhdnpgllgsgahlrqtlghil | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.36 | Rfree | 0.267 | | Matthews' coefficent | 2.69 | Rfactor | 0.20619 | | Waters | 387 | Solvent Content | 54.19 |
| Ligand Information | | Ligands | | | Metals | | | |
