| Title | Crystal Structure of Escherichia coli PdxA, an Enzyme Involved in the Pyridoxal Phosphate Biosynthesis Pathway. J.Biol.Chem. 278 43682-43690 2003 | | Site | BSGI | | PDB Id | | Target Id | PDXA_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11960, | Molecular Weight | 35111.83 Da. | | Residues | 329 | Isoelectric Point | 5.87 | | Sequence | mvktqrvvitpgepagigpdlvvqlaqrewpvelvvcadatlltnraamlglpltlrpyspnspaqpqt agtltllpvalrapvtagqlavenghyvvetlaracdgclngefaalitgpvhkgvindagipftghte ffeersqakkvvmmlateelrvalatthlplrdiadaitpallheviailhhdlrtkfgiaeprilvcg lnphagegghmgteeidtiipvlnelraqgmklngplpadtlfqpkyldnadavlamyhdqglpvlkyq gfgrgvnitlglpfirtsvdhgtalelagrgkadvgsfitalnlaikmivntq | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.96 | Rfree | 0.267 | | Matthews' coefficent | 2.38 | Rfactor | 0.217 | | Waters | 263 | Solvent Content | 47.80 |
| Ligand Information | | Ligands | PO4 (PHOSPHATE) x 1 | | Metals | ZN (ZINC) x 2 | | |
