| Title | Crystal structure of the RluD pseudouridine Synthase catalytic module, an enzyme that modifies 23S rRNA and is essential for normal cell growth of Escherichia coli. J.Mol.Biol. 335 87-101 2003 | | Site | BSGI | | PDB Id | | Target Id | RLUD_ECO57 | | Molecular Characteristics | | Source | Escherichia coli o157:h7 edl933 | | Alias Ids | TPS11988, | Molecular Weight | 37130.76 Da. | | Residues | 326 | Isoelectric Point | 6.31 | | Sequence | maqrvqltatvsenqlgqrldqalaemfpdysrsrikewildqrvlvngklcdkpkekvlggeqvaina eieeearfepqdipldivyedediivinkprdlvvhpgagnpdgtxlnallhyyppiadvpragivhrl dkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhptkrthmavhpmgkp avthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyggrprppkgaseafistlrkfdr qalhatmlrlyhpisgiemewhapipqdmvelievmradfeehkdevdwl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.80 | Rfree | 0.243 | | Matthews' coefficent | 2.64 | Rfactor | 0.218 | | Waters | 294 | Solvent Content | 53.00 |
| Ligand Information | | Ligands | | | Metals | | | |
