| Title | Molecules of Escherichia coli MobB assemble into densely packed hollow cylinders in a crystal lattice with 75% solvent content. Acta Crystallogr.,Sect.D 59 2348-2352 2003 | | Site | BSGI | | PDB Id | | Target Id | MOBB_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11942, | Molecular Weight | 18873.74 Da. | | Residues | 170 | Isoelectric Point | 5.19 | | Sequence | mipllafaawsgtgkttllkklipalcargirpglikhthhdmdvdkpgkdsyelrkagaaqtivasqq rwalmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdgaghrpeelvidrhviavas dvplnldvalldindvegladfvvewmqkqng | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.80 | Rfree | 0.308 | | Matthews' coefficent | | Rfactor | 0.275 | | Waters | 55 | Solvent Content | |
| Ligand Information | | Ligands | SO4 (SULFATE) x 2 | | Metals | | | |
