.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p9n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Molecules of Escherichia coli MobB assemble into densely packed hollow cylinders in a crystal lattice with 75% solvent content. Acta Crystallogr.,Sect.D 59 2348-2352 2003
    Site BSGI
    PDB Id 1p9n Target Id MOBB_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11942, Molecular Weight 18873.74 Da.
    Residues 170 Isoelectric Point 5.19
    Sequence mipllafaawsgtgkttllkklipalcargirpglikhthhdmdvdkpgkdsyelrkagaaqtivasqq rwalmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdgaghrpeelvidrhviavas dvplnldvalldindvegladfvvewmqkqng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.308
    Matthews' coefficent Rfactor 0.275
    Waters 55 Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch