| Title | The solution structure of YbcJ from Escherichia coli reveals a recently discovered alphaL motif involved in RNA binding. J.Bacteriol. 185 4204-4210 2003 | | Site | BSGI | | PDB Id | | Target Id | YBCJ_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11968, | Molecular Weight | 7389.16 Da. | | Residues | 70 | Isoelectric Point | 7.84 | | Sequence | matfslgkhphvelcdllklegwsesgaqakiaiaegqvkvdgavetrkrckivagqtvsfaghsvqvva | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
