| Title | Crystal Structure of a Trimeric Form of Dephosphocoenzyme A Kinase from Escherichia coli. Protein Sci. 12 327-336 2003 | | Site | BSGI | | PDB Id | | Target Id | COAE_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11967, | Molecular Weight | 22620.48 Da. | | Residues | 206 | Isoelectric Point | 5.77 | | Sequence | mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmiaadgtlqrra lrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetql krtmqrddvtrehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlasqfvsqekp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.80 | Rfree | 0.246 | | Matthews' coefficent | 2.45 | Rfactor | 0.217 | | Waters | 449 | Solvent Content | 49.44 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 10 | | Metals | | | |
