.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lkz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of D-ribose-5-phosphate isomerase (RpiA) from Escherichia coli. Proteins 48 737-740 2002
    Site BSGI
    PDB Id 1lkz Target Id RPIA_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11964, Molecular Weight 22859.15 Da.
    Residues 219 Isoelectric Point 5.20
    Sequence mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklkslgihvfd lnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadaskqvdilgkfplpvevipm arsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenainaipgvvtvglfanrgadval igtpdgvktivk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.27
    Matthews' coefficent 2.62 Rfactor 0.227
    Waters 129 Solvent Content 53.14

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch