| Title | Solution Structure of the Closed Form of a Peptidyl-Prolyl Isomerase Reveals the Mechanism of Protein Folding. To be Published | | Site | BSGI | | PDB Id | | Target Id | TIG_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11966, | Molecular Weight | 48190.18 Da. | | Residues | 432 | Isoelectric Point | 4.83 | | Sequence | mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqrygasvrqdvlgd lmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgleaievekpivevtdadvd gmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgqgrmipgfedgikghka geeftidvtfpeeyhaenlkgkaakfainlkkveerelpeltaefikrfgvedgsveglraevrknmer elksairnrvksqaieglvkandidvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrv vvglllgevirtnelkadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlak akvtekettfnelmnqqa | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
