| Title | Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP. Nat.Struct.Biol. 9 353-358 2002 | | Site | BSGI | | PDB Id | | Target Id | RSUA_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11965, | Molecular Weight | 25863.97 Da. | | Residues | 231 | Isoelectric Point | 5.75 | | Sequence | mrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqqhgpryfmlnkpq gyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwshritsprhhcektylvtles pvaddtaeqfakgvqlhnekdltkpavlevitptqvrltisegryhqvkrmfaavgnhvvelhrerigg itldadlapgeyrplteeeiasvv | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.10 | Rfree | 0.2580000 | | Matthews' coefficent | 2.50 | Rfactor | 0.2260000 | | Waters | 183 | Solvent Content | 50.81 |
| Ligand Information | | Ligands | URA (URACIL) x 1 | | Metals | | | |
