.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ksl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP. Nat.Struct.Biol. 9 353-358 2002
    Site BSGI
    PDB Id 1ksl Target Id RSUA_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11965, Molecular Weight 25863.97 Da.
    Residues 231 Isoelectric Point 5.75
    Sequence mrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqqhgpryfmlnkpq gyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwshritsprhhcektylvtles pvaddtaeqfakgvqlhnekdltkpavlevitptqvrltisegryhqvkrmfaavgnhvvelhrerigg itldadlapgeyrplteeeiasvv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2580000
    Matthews' coefficent 2.50 Rfactor 0.2260000
    Waters 183 Solvent Content 50.81

    Ligand Information
    Ligands URA (URACIL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch