.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kk9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of the YciO protein from Escherichia coli. PROTEINS: STRUCT.,FUNCT.,GENET. 49 139-141 2002
    Site BSGI
    PDB Id 1kk9 Target Id YCIO_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11969, Molecular Weight 23210.55 Da.
    Residues 206 Isoelectric Point 5.97
    Sequence msqffyihpdnpqqrlinqaveivrkggvivyptdsgyalgckiedknamericrirqlpdghnftlmc rdlselstysfvdnvafrlmknntpgnytfilkgtkevprrllqekrktigmrvpsnpiaqallealge pmlstslmlpgseftesdpeeikdrlekqvdliihggylgqkpttvidltddtpvvvregvgdvkpfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.233
    Matthews' coefficent 3.47 Rfactor 0.213
    Waters 126 Solvent Content 64.60

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch