| Title | Mechanism of action and NAD+-binding mode revealed by the crystal structure of L-histidinol dehydrogenase. Proc.Natl.Acad.Sci.USA 99 1859-1864 2002 | | Site | BSGI | | PDB Id | | Target Id | HISX_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11957, | Molecular Weight | 46107.65 Da. | | Residues | 434 | Isoelectric Point | 5.06 | | Sequence | msfntiidwnsctaeqqrqllmrpaisasesitrtvndildnvkargdealreysakfdkttvtalkvs aeeiaaaserlsdelkqamavavknietfhtaqklppvdvetqpgvrcqqvtrpvasvglyipggsapl fstvlmlatpasiagckkvvlcspppiadeilyaaqlcgvqdvfnvggaqaiaalafgtesvpkvdkif gpgnafvteakrqvsqrldgaaidmpagpsevlviadsgatpdfvasdllsqaehgpdsqvilltpaad marrvaeaverqlaelpraetarqalnasrlivtkdlaqcveisnqygpehliiqtrnarelvdsitsa gsvflgdwspesagdyasgtnhvlptygytatcsslgladfqkrmtvqelskegfsalastietlaaae rltahknavtlrvnalkeqa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.75 | Rfree | 0.225 | | Matthews' coefficent | 2.47 | Rfactor | 0.19 | | Waters | 924 | Solvent Content | 50.26 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 4;GOL (GLYCEROL) x 1 | | Metals | | | |
