| Title | The Structure of the Rlmb 23S Rrna Methyltransferase Reveals a New Methyltransferase Fold with a Unique Knot. Structure 10 1303 2002 | | Site | BSGI | | PDB Id | | Target Id | RLMB_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11976, | Molecular Weight | 26555.16 Da. | | Residues | 243 | Isoelectric Point | 6.17 | | Sequence | msemiygihavqalleraperfqevfilkgredkrllplihalesqgvviqlanrqyldeksdgavhqg iiarvkpgrqyqendlpdliasldqpfllildgvtdphnlgaclrsadaagvhavivpkdrsaqlnata kkvacgaaesvplirvtnlartmrmlqeeniwivgtageadhtlyqskmtgrlalvmgaegegmrrltr ehcdelisipmagsvsslnvsvatgiclfeavrqrs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.5 | Rfree | 0.279 | | Matthews' coefficent | 2.249 | Rfactor | 0.231 | | Waters | 177 | Solvent Content | 43 |
| Ligand Information | | Ligands | | | Metals | | | |
