| Title | Crystal structure of histidinol phosphate aminotransferase (HisC) from Escherichia coli, and its covalent complex with pyridoxal-5'-phosphate and l-histidinol phosphate. J.Mol.Biol. 311 761-776 2001 | | Site | BSGI | | PDB Id | | Target Id | HIS8_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11956, | Molecular Weight | 39357.94 Da. | | Residues | 356 | Isoelectric Point | 5.01 | | Sequence | mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpkavienyaq yagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigvecrtvptldnwqldlq gisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvadeayiefcpqaslagwlaeyphla ilrtlskafalaglrcgftlaneevinllmkviapyplstpvadiaaqalspqgivamrervaqiiaer eyliaalkeipcveqvfdsetnyilarfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesq rvidalraeqv | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.50 | Rfree | 0.2190000 | | Matthews' coefficent | 2.29 | Rfactor | 0.2050000 | | Waters | 224 | Solvent Content | 46.35 |
| Ligand Information | | Ligands | PMP (4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE) x 1 | | Metals | | | |
