| Title | The crystal structure of Escherichia coli MoeA, a protein from the molybdopterin synthesis pathway. J.Mol.Biol. 310 419-431 2001 | | Site | BSGI | | PDB Id | | Target Id | MOEA_ECOLI | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11943, | Molecular Weight | 44064.85 Da. | | Residues | 411 | Isoelectric Point | 5.03 | | Sequence | mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrladia sgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrftaevrsgqnirr rgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstgdelqlpgqplgdgqiydtnrl avhlmleqlgcevinlgiirddphalraafieadsqadvvissggvsvgeadytktileelgeiafwkl aikpgkpfafgklsnswfcglpgnpvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgr ldfqrgvlqrnadgelevtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.20 | Rfree | 0.2970000 | | Matthews' coefficent | 2.27 | Rfactor | 0.2530000 | | Waters | 500 | Solvent Content | 45.76 |
| Ligand Information | | Ligands | | | Metals | MG (MAGNESIUM) x 2 | | |
