| Title | Crystal structure of hexameric DsrEFH. To be Published | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR31216 | | Related PDB Ids 2hy5 | | Molecular Characteristics | | Source | Allochromatium vinosum | | Alias Ids | TPS8720, | Molecular Weight | 11084.04 Da. | | Residues | 102 | Isoelectric Point | 4.70 | | Sequence | msilhtvnkspfernslesclkfategasvllfedgiyaalagtrvesqvtealgklklyvlgpdlkar gfsdervipgisvvdyagfvdlttecdtvqawl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 6 | | Resolution (Å) | 2.50 | Rfree | 0.262 | | Matthews' coefficent | 2.22 | Rfactor | 0.206 | | Waters | 418 | Solvent Content | 44.67 |
| Ligand Information | | Ligands | | | Metals | | | |
