.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z0u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of an NAD Kinase from Archaeoglobus fulgidus in Complex with ATP, NAD, or NADP. J.Mol.Biol. 354 289-303 2005
    Site BSGC
    PDB Id 1z0u Target Id BSGCAIR30424
    Related PDB Ids 1suw 1z0s 1z0z 
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8673, Molecular Weight 27866.95 Da.
    Residues 249 Isoelectric Point 6.25
    Sequence mraavvyktdghvkrieealkrlevevelfnqpseelenfdfivsvggdgtilrilqklkrcppifgin tgrvgllthaspenfevelkkavekfeverfprvscsampdvlalneiavlsrkpakmidvalrvdgve vdrircdgfivatqigstgyafsaggpvvepylecfilipiapfrfgwkpyvvsmerkieviaekaivv adgqksvdfdgeitieksefpavffknekrfrnlfgkvrsig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.26357
    Matthews' coefficent 2.34 Rfactor 0.21164
    Waters 262 Solvent Content 45.50

    Ligand Information
    Ligands SO4 (SULFATE) x 3;NAP (NADP) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch