| Title | Crystal structures of a phosphotransacetylase from Bacillus subtilis and its complex with acetyl phosphate. J.STRUCT.FUNCT.GENOM. 6 269-279 2005 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30616 | | Related PDB Ids 1td9 | | Molecular Characteristics | | Source | Bacillus subtilis | | Alias Ids | TPS8707, | Molecular Weight | 34788.73 Da. | | Residues | 323 | Isoelectric Point | 4.84 | | Sequence | madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakelnltlggvki ydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladglvsgaahstadtvrpalq iiktkegvkktsgvfimargeeqyvfadcainiapdsqdlaeiaiesantakmfdieprvamlsfstkg saksdetekvadavkiakekapeltldgefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigy kiaqrlgnfeavgpilqglnmpvndlsrgcnaedvynlalitaaqal | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 6 | | Resolution (Å) | 2.85 | Rfree | 0.288 | | Matthews' coefficent | 3.08 | Rfactor | 0.245 | | Waters | 102 | Solvent Content | 60.00 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 3;UVW (ACETYLPHOSPHATE) x 23 | | Metals | | | |
