| Title | Crystal structure of the conserved hypothetical protein MPN330 (GI: 1674200) from Mycoplasma pneumoniae. Proteins 58 504-508 2004 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30529 | | Molecular Characteristics | | Source | Mycoplasma pneumoniae | | Alias Ids | TPS8693, | Molecular Weight | 34133.68 Da. | | Residues | 294 | Isoelectric Point | 5.82 | | Sequence | minkpnqfvnhlsalkkhfasykelreafndyhkhngdelttfflhqfdkvmelvkqkdfktaqsrcee elaapylpkplvsffqsllqlvnhdlleqqnaalaslpaakiielvlqdypnklnmihyllpktkafvk phllqrlqfvltdsellelkrfsffqalnqipgfqgeqveyfnsklkqkftltlgefeiaqqpdakayf eqlitqiqqlflkepvnaefaneiidaflvsyfplhppvplaqlaakiyeyvsqivlneavnlkdelik livhtlyeqldrpvgden | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.50 | Rfree | 0.298 | | Matthews' coefficent | 2.96 | Rfactor | 0.244 | | Waters | 50 | Solvent Content | 58.00 |
| Ligand Information | | Ligands | | | Metals | | | |
