.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t6z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ADP bound FAD synthetase. To be Published
    Site BSGC
    PDB Id 1t6z Target Id BSGCAIR30409
    Related PDB Ids 1mrz 1s4m 1t6x 1t6y 2i1l 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8663, Molecular Weight 33612.10 Da.
    Residues 293 Isoelectric Point 8.77
    Sequence mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrvemlsryart vvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgvevyeiedvvvqgkrvsss lirnlvqegrveeipaylgryfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdg kkkfgvmnvgfrptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvks arnmiddiinskfekeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.295
    Matthews' coefficent 2.50 Rfactor 0.225
    Waters 152 Solvent Content 50.00

    Ligand Information
    Ligands RBF (RIBOFLAVINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch