| Title | Structural Studies of the Nudix Hydrolase DR1025 From Deinococcus radiodurans and its Ligand Complexes. J.Mol.Biol. 339 103-116 2004 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30561 | | Related PDB Ids 1sjy 1soi 1su2 | | Molecular Characteristics | | Source | Deinococcus radiodurans | | Alias Ids | TPS8700, | Molecular Weight | 17568.04 Da. | | Residues | 159 | Isoelectric Point | 5.01 | | Sequence | mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqdaavreacee tglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvsredfaqlyaagqirm yqtklfyadalrekgfpalpv | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.60 | Rfree | 0.234 | | Matthews' coefficent | 2.44 | Rfactor | 0.213 | | Waters | 223 | Solvent Content | 47.75 |
| Ligand Information | | Ligands | GNP (PHOSPHOAMINOPHOSPHONIC) x 2 | | Metals | MG (MAGNESIUM) x 2 | | |