.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sum

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of a PhoU protein homologue: a new class of metalloprotein containing multinuclear iron clusters. J.Biol.Chem. 280 15960-15966 2005
    Site BSGC
    PDB Id 1sum Target Id BSGCAIR30480
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8681, Molecular Weight 26819.78 Da.
    Residues 235 Isoelectric Point 4.70
    Sequence mnrllnekveefkkgvlkagwfiekmfrnsisslverneslareviadeevvdqmeveiqekamevlgl fspigkplltvtagirvaelieniadkchdiaknvlelmeepplkpledipamanqtsemlkfalrmfa dvnveksfevcrmdskvddlyekvreelllymmespkyvkralllleiagnieiiadyatnivevsvym vqgeaykcyhdelllfkksggvlfessd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.25489
    Matthews' coefficent 2.00 Rfactor 0.2166
    Waters 78 Solvent Content 38.51

    Ligand Information
    Ligands PO3 (PHOSPHITE) x 2
    Metals FE (FE) x 7;NI (NICKEL) x 1;CA (CALCIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch