| Title | Crystal structure of a PhoU protein homologue: a new class of metalloprotein containing multinuclear iron clusters. J.Biol.Chem. 280 15960-15966 2005 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30480 | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS8681, | Molecular Weight | 26819.78 Da. | | Residues | 235 | Isoelectric Point | 4.70 | | Sequence | mnrllnekveefkkgvlkagwfiekmfrnsisslverneslareviadeevvdqmeveiqekamevlgl fspigkplltvtagirvaelieniadkchdiaknvlelmeepplkpledipamanqtsemlkfalrmfa dvnveksfevcrmdskvddlyekvreelllymmespkyvkralllleiagnieiiadyatnivevsvym vqgeaykcyhdelllfkksggvlfessd | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.25489 | | Matthews' coefficent | 2.00 | Rfactor | 0.2166 | | Waters | 78 | Solvent Content | 38.51 |
| Ligand Information | | Ligands | PO3 (PHOSPHITE) x 2 | | Metals | FE (FE) x 7;NI (NICKEL) x 1;CA (CALCIUM) x 1 | | |
