| Title | Crystal structure of a heat-inducible transcriptional repressor HrcA from Thermotoga maritima: structural insight into DNA binding and dimerization. J.Mol.Biol. 350 987-996 2005 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30318 | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS8322, | Molecular Weight | 39304.43 Da. | | Residues | 338 | Isoelectric Point | 9.24 | | Sequence | mrrlnrknnealkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiy qphtsagriptdkglrfyyeemlkisketseadlavetfksmpladpekvlflagnllarltegyvlie rpntrdlkilrvmlipvsedylifsiltefgvskvtpiktqerlnweeierqlnfllrgrtvgevlmgk ieslkgsgflrliesligetveryldaglenllkdetltledirnlleevkdqkfleslvgegitvrig reigrkklekfavfsgkyfkgespigsvylftskvtkydrnhrvfeyilnrlseyftstsrr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.20 | Rfree | 0.25753 | | Matthews' coefficent | 2.61 | Rfactor | 0.21494 | | Waters | 450 | Solvent Content | 52.78 |
| Ligand Information | | Ligands | | | Metals | | | |
