.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sjy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structural Studies of the Nudix Hydrolase DR1025 From Deinococcus radiodurans and its Ligand Complexes. J.Mol.Biol. 339 103-116 2004
    Site BSGC
    PDB Id 1sjy Target Id BSGCAIR30561
    Related PDB Ids 1soi 1su2 1sz3 
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8697, Molecular Weight 17568.04 Da.
    Residues 159 Isoelectric Point 5.01
    Sequence mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqdaavreacee tglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvsredfaqlyaagqirm yqtklfyadalrekgfpalpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.39 Rfree 0.242
    Matthews' coefficent 2.45 Rfactor 0.228
    Waters 102 Solvent Content 50.07

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch