| Title | Structure of the putative DNA-binding protein SP_1288 from Streptococcus pyogenes. Acta Crystallogr.,Sect.D 60 1266-1271 2004 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30594 | | Molecular Characteristics | | Source | Streptococcus pyogenes | | Alias Ids | TPS8705, | Molecular Weight | 13589.62 Da. | | Residues | 113 | Isoelectric Point | 4.52 | | Sequence | mnimeiektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnikrtekilety emklhmysdyvvrseifddmiahyphdeylqekisiltsidnre | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.31 | Rfree | 0.23686 | | Matthews' coefficent | 3.19 | Rfactor | 0.20651 | | Waters | 103 | Solvent Content | 61.17 |
| Ligand Information | | Ligands | | | Metals | | | |
