| Title | Structural and functional characterization of a novel phosphodiesterase from Methanococcus jannaschii. J.Biol.Chem. 279 31854-31862 2004 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30314 | | Related PDB Ids 1s3l 1s3m | | Molecular Characteristics | | Source | Methanococcus jannaschii | | Alias Ids | TPS8321, | Molecular Weight | 19037.61 Da. | | Residues | 166 | Isoelectric Point | 4.61 | | Sequence | mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnndgercklke wlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviyghthervfeevddvlvinpg eccgyltgiptigildtekkeyreivle | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.50 | Rfree | 0.253 | | Matthews' coefficent | 2.78 | Rfactor | 0.22 | | Waters | 60 | Solvent Content | 55.74 |
| Ligand Information | | Ligands | | | Metals | MN (MANGANESE) x 4 | | |
