| Title | Structural and functional characterization of a novel phosphodiesterase from Methanococcus jannaschii. J.Biol.Chem. 279 31854-31862 2004 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30314 | | Related PDB Ids 1s3m 1s3n | | Molecular Characteristics | | Source | Methanococcus jannaschii | | Alias Ids | TPS8284, | Molecular Weight | 19037.61 Da. | | Residues | 166 | Isoelectric Point | 4.61 | | Sequence | mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnndgercklke wlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviyghthervfeevddvlvinpg eccgyltgiptigildtekkeyreivle | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.40 | Rfree | 0.253 | | Matthews' coefficent | 2.99 | Rfactor | 0.226 | | Waters | 45 | Solvent Content | 58.82 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 2;PO4 (PHOSPHATE) x 1 | | Metals | | | |
